PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015351-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YB
Protein Properties Length: 179aa    MW: 19910.2 Da    PI: 6.2796
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015351-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.36.1e-5535130297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal+tlGf+dy+eplk yl+++relegek
  NNU_015351-RA  35 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALGTLGFDDYAEPLKRYLHRFRELEGEK 130
                    79********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.1E-5330138IPR009072Histone-fold
SuperFamilySSF471133.11E-4037138IPR009072Histone-fold
PfamPF008087.7E-2840104IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.8E-196886No hitNo description
PROSITE patternPS0068507187IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.8E-1987105No hitNo description
PRINTSPR006156.8E-19106124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MVDNIGSHGP NSEGNKYKIA GGAASTSSGD DRSLKEQDRL LPIANVGRIM KQILPPNAKI  60
SKEAKETMQE CVSEFISFVT GEASDKCHKE KRKTVNGDDI CWALGTLGFD DYAEPLKRYL  120
HRFRELEGEK ANQDKGSNIE NREAPSFFGC DKTREQPLSS TPLDFNVFEK SNSSMSRPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4434125192Transcription factor HapC (Eurofung)
4g92_B2e-4434125192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4297062e-79AM429706.1 Vitis vinifera contig VV78X144965.37, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010269452.11e-132PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO822482e-61NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA5ALQ92e-86A5ALQ9_VITVI; Putative uncharacterized protein
STRINGVIT_07s0104g01640.t011e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.11e-62nuclear factor Y, subunit B5